The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title NMR solution structure of TnpE protein from Shigella flexneri. Northeast Structural Genomics Target SfR125. To be Published
    Site NESGC
    PDB Id 2rn7 Target Id SfR125
    Molecular Characteristics
    Source Shigella flexneri
    Alias Ids TPS9126,PF01527, 1101, 1.10.1680.10 Molecular Weight 12554.48 Da.
    Residues 108 Isoelectric Point 9.61
    Sequence mtkntrfspevrqravrmvlesqgeydsqwaticsiapkigctpetlrvwgrqherdtgggdgglttae rqrlkeperenrelrrsndilrqasayfakaefdrlwkk
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information


    Google Scholar output for 2rn7

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch