.
The Open Protein Structure Annotation Network
PDB Keyword
.

2rad

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the succinoglycan biosynthesis protein. To be Published
    Site NESGC
    PDB Id 2rad Target Id BcR135
    Related PDB Ids 3b55 
    Molecular Characteristics
    Source Bacillus cereus
    Alias Ids TPS8747,3.40.1660.10, 3.30.1870.10, 1.20.1440.30, PF05139 Molecular Weight 50085.86 Da.
    Residues 443 Isoelectric Point 8.99
    Sequence mkkkiiiaivasaitmthfvgntyadsktevsvtapyntnqiakwleahakplkttnptaslndlkplk nmvgsasivglgeathgahevftmkhrivkylvsekgftnlvleegwdraleldryvltgkgnpsqhlt pvfktkemldlldwirqynanpkhkskvrvigmdiqsvnenvynniieyikannskllprveekikgli pvtkdmntfesltkeekekyvldakqisalleenksylngkskefawikqnariieqfttmlatppdkp adfylkhdiamyenakwteehlgktivwghnghvsktnmlsfiypkvagqhlaeyygkryvsigtsvye gqynvknsdgefgpygtlksddpnsynyifgqvkkdqffidlrkangvtktwlneqhpifagittegpd ipktvdislgkafdilvqiqkvspsqvhq
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.75 Rfree 0.281
    Matthews' coefficent 2.26 Rfactor 0.209
    Waters 31 Solvent Content 45.54

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2rad

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch