.
The Open Protein Structure Annotation Network
PDB Keyword
.

2r76

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the rare lipoprotein B (SO_1173) from Shewanella oneidensis. To be Published
    Site NESGC
    PDB Id 2r76 Target Id SoR91A
    Molecular Characteristics
    Source Shewanella oneidensis
    Alias Ids TPS9157,PF04390, 3.30.160.150 Molecular Weight 16566.05 Da.
    Residues 144 Isoelectric Point 5.14
    Sequence mgfklqrsyqipeqlnqlslsssdeyseltrlvrerlrlnnvkivdaandvpvlrlitdslerstlsly ptgnvaeyeliyfvefavalpgkeaqpfkieirrdylddprtalaksremellvkemriqaadrilqsm astevn
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.60 Rfree 0.293
    Matthews' coefficent 3.04 Rfactor 0.247
    Waters 38 Solvent Content 59.58

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2r76
    1. The complex that inserts lipopolysaccharide into the bacterial outer membrane forms a two-protein plug-and-barrel
    E Freinkman, SS Chng - Proceedings of the , 2011 - National Acad Sciences
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch