.
The Open Protein Structure Annotation Network
PDB Keyword
.

2qgs

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of SE1688 protein from Staphylococcus epidermidis. To be Published
    Site NESGC
    PDB Id 2qgs Target Id SeR89
    Molecular Characteristics
    Source Staphylococcus epidermidis
    Alias Ids TPS9125,1.10.472.50, 1.10.3210.10, PF01966, BIG_264 Molecular Weight 25360.58 Da.
    Residues 217 Isoelectric Point 6.18
    Sequence mnsrmkikkayeymksfhqhdttghdiahvervynnacyiakrenitdtlvielssllhdtvdskltde ilaydqlkqflstldlsseisqqvlyiikhmsyragknnhvklsidgeivrdadrldaigaigiartfq fsghfgepmwtetklsneelhtslveeldnsaikhfyeklfklkdlmhtptakklaeerhqfmiqylkq fmsewnfnke
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.00 Rfree 0.244
    Matthews' coefficent 2.27 Rfactor 0.208
    Waters 410 Solvent Content 45.86

    Ligand Information
    Ligands
    Metals ZN (ZINC) x 2

    Jmol

     
    Google Scholar output for 2qgs

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch