The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site NESGC
    PDB Id 2qgq Target Id VR77
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS9221,, PF04055, PF00919,, Molecular Weight 49219.73 Da.
    Residues 430 Isoelectric Point 4.87
    Sequence mrvgikvlgcpkneadcevlagvlreggheivfdvkdadvvvldtcafiedakresideifsfvdakdq ygyklvvkgclvqryyeelkkeipevdqwigvadpeeianaiengtdlvpdqpetvyryrkridleerp yayvkisdgcdrgctfcsipsfkgslrsrsieditrevedllkegkkeiilvaqdttsygidlyrkqal pdllrrlnslngefwirvmylhpdhlteeiisamleldkvvkyfdvpvqhgsdkilklmgrtksseelk kmlssirerfpdavlrtsiivgfpgeteedfeelkqfveeiqfdklgafvysdeegtvafnlkekvdpe makrrqeellllqaeisnsrldrfvgkklkflvegkegkflvgrtwteapevdgvvfvrgkgkigdfle vvikehdeydmwgsvi
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 8
    Resolution (Å) 2.00 Rfree 0.251
    Matthews' coefficent 2.66 Rfactor 0.212
    Waters 1443 Solvent Content 53.74

    Access denied for user 'root'@'localhost' (using password: YES) (click for details)

    Ligand Information


    Google Scholar output for 2qgq
    1. Post-translational Modification of Ribosomal Proteins
    S Arragain, R Garcia-Serres, G Blondin, T Douki - Journal of Biological , 2010 - ASBMB
    2. Radical SAM Enzymes in Methylation and Methylthiolation
    RU Hutcheson, JB Broderick - Metallomics, 2012 - pubs.rsc.org
    3. Structural Diversity in the AdoMet Radical Enzyme Superfamily
    DP Dowling, JL Vey, AK Croft, CL Drennan - Biochimica et Biophysica Acta , 2012 - Elsevier

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch