.
The Open Protein Structure Annotation Network
PDB Keyword
.

2qgm

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of succinoglycan biosynthesis protein at the resolution 1.7 A. Northeast Structural Genomics Consortium target BcR136. To be Published
    Site NESGC
    PDB Id 2qgm Target Id BcR136
    Molecular Characteristics
    Source Bacillus cereus
    Alias Ids TPS8749,3.40.1660.10, 3.30.1870.10, 1.20.1440.30, PF05139 Molecular Weight 50524.49 Da.
    Residues 445 Isoelectric Point 8.48
    Sequence mnkkrmiamvstallvtgcaevgnaqtvavensgqsvqknivksiqsqanplktiepskpfedlkplkk mignaqyvglgenthgsseiftmkfrlvkylvtemgftnfameedwgnglklneyiqtgkgnpreflkl lyptdeiiamiewmkdynadpsnkkkiqfigldlkaldqgsfnkvidyvrlhrpdllaeveenykelss ftgsiqeymkltpklkekfkanaervarllkdeneqanteiipseyiwakatasaiekfttmllpndyp siiklheqyladhamwaqetfggktmvwahnihiakgiideklypyvagqflkerldnnyvtigsttte gnftlyseynpstggkittdtipqdvksfnytlgkvpykmflldnrhlkgqaekwvkakrpllsiggqi lpnssvyfdtslleqfdiifhirktspshik
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.70 Rfree 0.255
    Matthews' coefficent 2.12 Rfactor 0.229
    Waters 256 Solvent Content 41.95

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2qgm
    1. Mechanism and Diversity of the Erythromycin Esterase Family of Enzymes
    M Morar, K Pengelly, K Koteva, GD Wright - Biochemistry, 2012 - ACS Publications
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch