.
The Open Protein Structure Annotation Network
PDB Keyword
.

2qgg

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-Ray structure of the protein Q6F7I0 from Acinetobacter calcoaceticus AmMS 248. To be Published
    Site NESGC
    PDB Id 2qgg Target Id AsR73
    Molecular Characteristics
    Source Acinetobacter sp. (strain adp1)
    Alias Ids TPS8727,2.30.30.240, 2.40.30.60, PF01782, PF05239 Molecular Weight 20817.42 Da.
    Residues 182 Isoelectric Point 4.66
    Sequence mtptqnvpedriqigqlrsayglngwlwvysntepmsnmfdylpwfietkagwqtvdvkrwkphgkglv vslknvsdrnaaesligstiwvaksqlpktdvdeyywsdlkgltvlgldeeeqevnlgqihelfetgan dvmvvratadsvdaeermipwhkdvvqrvdleagriyvnwgvdy
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.40 Rfree 0.256
    Matthews' coefficent 2.75 Rfactor 0.207
    Waters 52 Solvent Content 55.33

    Ligand Information
    Ligands UNL (UNKNOWN) x 1
    Metals K (POTASSIUM) x 1

    Jmol

     
    Google Scholar output for 2qgg

    Protein Summary

     

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch