.
The Open Protein Structure Annotation Network
PDB Keyword
.

2qai

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the V-type ATP synthase subunit F from Pyrococcus furiosus. To be Published
    Site NESGC
    PDB Id 2qai Target Id PfR7
    Molecular Characteristics
    Source Pyrococcus furiosus
    Alias Ids TPS9020,PF01990, 3.40.50.10580 Molecular Weight 11738.96 Da.
    Residues 103 Isoelectric Point 5.21
    Sequence mkivvmgdsdtvvgfrlagvheayeydeslesverarnklrellerddvgiiliterlaqrigslpevk fpiilqipdkfgsiygedilrdvvrraigvelkr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.40 Rfree 0.238
    Matthews' coefficent 2.40 Rfactor 0.215
    Waters 82 Solvent Content 48.70

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2qai
    1. Three-dimensional structure of A1A0 ATP synthase from the hyperthermophilic archaeon Pyrococcus furiosus by electron microscopy
    J Vonck, KY Pisa, N Morgner, B Brutschy - Journal of Biological , 2009 - ASBMB
     
    2. Crystallization and preliminary X-ray crystallographic analysis of subunit F (F1-94), an essential coupling subunit of the eukaryotic V1VO-ATPase from Saccharomyces
    S Basak, AM Balakrishna - Section F: Structural , 2012 - scripts.iucr.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch