.
The Open Protein Structure Annotation Network
PDB Keyword
.

2psb

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of YerB protein from Bacillus subtilis. To be Published
    Site NESGC
    PDB Id 2psb Target Id SR586
    Molecular Characteristics
    Source Bacillus subtilis
    Alias Ids TPS9113,3.50.90.10, PF11258 Molecular Weight 34746.36 Da.
    Residues 312 Isoelectric Point 7.07
    Sequence mqqkdavpdtakklkapltglkteqkvterrpvavvvnnhpkarpqsglskadiviealaegqitrfla ifqsqmpetvgpvrsareyfvtlsngfdsifvhhgwspgakkqlesgaadymngldfdgslfwradfsk pphnsytsydyikkaaeqkgyklkqetnpllfqtsdakpanesynvrvdygtnnvtnlveynydkkaef ytrssdgvittdretgkpvamqnifiveashhiidqdgrrdidlesggkgllfqhgnvietdwkqvngr ivpvkdgkwlpfvpgktwinivpdldaasiskgegv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.10 Rfree 0.269
    Matthews' coefficent 1.93 Rfactor 0.218
    Waters 132 Solvent Content 36.13

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2psb

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch