.
The Open Protein Structure Annotation Network
PDB Keyword
.

2pkw

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of UPF0341 protein yhiQ from Salmonella typhimurium. To be Published
    Site NESGC
    PDB Id 2pkw Target Id StR221
    Molecular Characteristics
    Source Salmonella typhimurium
    Alias Ids TPS9170,3.40.1630.10, PF04445, 3.40.50.150 Molecular Weight 27298.95 Da.
    Residues 252 Isoelectric Point 6.09
    Sequence mqiclmdetgatdgalsvlaarwglehdednpmalvmtpqhlelrkrdepklggifvdfvggamahrrk fgggrgeavakavgikgdylpdvvdataglgrdafvlasvgcrvrmlernpvvaallddgltrgyadad iggwlqerlqlihassltaltditprpqvvyldpmfphrqksalvkkemrvfqslvgpdldadgllepa rqlatkrvvvkrpdyappladvatpnaivtkghrfdiyagtplte
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.10 Rfree 0.259
    Matthews' coefficent 1.99 Rfactor 0.208
    Waters 144 Solvent Content 38.21

    Ligand Information
    Ligands TRS (2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL) x 1
    Metals

    Jmol

     
    Google Scholar output for 2pkw
    1. YhiQ is RsmJ, the methyltransferase responsible for methylation of G1516 in 16S rRNA of E. coli
    GN Basturea, DR Dague, MP Deutscher - Journal of molecular , 2011 - Elsevier
     
    2. MarkUs: a server to navigate sequencestructurefunction space
    M Fischer, QC Zhang, F Dey, BY Chen - Nucleic Acids , 2011 - Oxford Univ Press
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch