.
The Open Protein Structure Annotation Network
PDB Keyword
.

2pjq

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of Q88U62_LACPL from Lactobacillus plantarum. To be Published
    Site NESGC
    PDB Id 2pjq Target Id LpR71
    Molecular Characteristics
    Source Lactobacillus plantarum
    Alias Ids TPS8958,1.10.472.50, 1.10.3210.10, PF01966, BIG_264 Molecular Weight 24328.20 Da.
    Residues 218 Isoelectric Point 6.34
    Sequence mitetqltaiqtyalqklahdhsghgrdhlqrvnrlarrlakdeganlnltlaaawlhdviddklmanp akahqdlivqlnaqnvtaddqtaifaiidhmsfsksfngpqklslegqvvqdadrldaigaigiaraly ysghvgekiydpaiaprehmtreqyrhqpgtainhfyeklfklaalmntdtakalaahrtavmhefvdq fkaewtaddka
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.80 Rfree 0.307
    Matthews' coefficent 2.03 Rfactor 0.236
    Waters 12 Solvent Content 39.49

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2pjq

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch