.
The Open Protein Structure Annotation Network
PDB Keyword
.

2pih

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of Protein ymcA from Bacillus subtilis. To be Published
    Site NESGC
    PDB Id 2pih Target Id SR375
    Molecular Characteristics
    Source Bacillus subtilis
    Alias Ids TPS9086,PF06133, 1.20.1500.10 Molecular Weight 16165.47 Da.
    Residues 143 Isoelectric Point 5.25
    Sequence mtlyskkdivqqarnlakmiseteevdffkraeaqinendkvstivnqikalqkqavnlkhyekhealk qveakidalqeeleeipviqefrdsqmevndllqlvahtisnqvtneiitstggdllkgetgskvkhsn nscsl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.10 Rfree 0.254
    Matthews' coefficent 2.15 Rfactor 0.207
    Waters 207 Solvent Content 42.79

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2pih
    1. Protein crystallography: a concise guide
    E Lattman, PJ Loll, P Loll - 2008 - books.google.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch