.
The Open Protein Structure Annotation Network
PDB Keyword
.

2pif

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of UPF0317 protein PSPTO_5379 from Pseudomonas syringae pv. tomato. To be Published
    Site NESGC
    PDB Id 2pif Target Id PsR181
    Molecular Characteristics
    Source Pseudomonas syringae
    Alias Ids TPS20386,3.40.1640.10, BIG_218, PF07286 Molecular Weight 28925.16 Da.
    Residues 268 Isoelectric Point 5.47
    Sequence mnafdrarqsaiaaareargtyrnglvtptagvapgmtqanlialprdwaydfllyaqrnpkacpildv sdagspttllaegsdlrtdipmyriwrdgklaeevsdatqawaehddmvafligcsftfetplqeagie vrhitdgcnvpmyrtnracrpagrlhgemvvsmrpipadrvaeasaisgrypsvhgapvhigepgrlgi ndlsrpdfgdavsikpgevpvfwacgvtpqaavmasgvpfaithspgymfitdvpdstyhv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.30 Rfree 0.272
    Matthews' coefficent 2.20 Rfactor 0.241
    Waters 190 Solvent Content 44.00

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2pif

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch