.
The Open Protein Structure Annotation Network
PDB Keyword
.

2ph1

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of nucleotide-binding protein AF2382 from Archaeoglobus fulgidus. To be Published
    Site NESGC
    PDB Id 2ph1 Target Id GR165
    Molecular Characteristics
    Source Archaeoglobus fulgidus
    Alias Ids TPS8889,PF10609, PF01656, 3.40.50.300, PF02374, BIG_766 Molecular Weight 27793.88 Da.
    Residues 254 Isoelectric Point 6.02
    Sequence mqkrvtdeeikerlgkiksriavmsgkggvgkstvtallavhyarqgkkvgildadflgpsipilfglr nariavsaeglepvltqkygikvmsmqfllpkentpviwrgpliagmireflgrvawgeldhllidlpp gtgdapltvmqdakptgvvvvstpqeltavivekainmaeetntsvlglvenmsyfvcpncghksyifg egkgeslakkynigfftsipieeelikladsgrieeyekdwfesapf
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.70 Rfree 0.278
    Matthews' coefficent 2.22 Rfactor 0.217
    Waters 37 Solvent Content 44.49

    Ligand Information
    Ligands
    Metals ZN (ZINC) x 1

    Jmol

     
    Google Scholar output for 2ph1

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch