.
The Open Protein Structure Annotation Network
PDB Keyword
.

2p7n

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the Pathogenicity island 1 effector protein from Chromobacterium violaceum. Northeast Structural Genomics Consortium (NESGC) target CvR69. To be Published
    Site NESGC
    PDB Id 2p7n Target Id CvR69
    Molecular Characteristics
    Source Chromobacterium violaceum
    Alias Ids TPS8812,PF06511 Molecular Weight 42220.74 Da.
    Residues 399 Isoelectric Point 5.01
    Sequence mygiqtsaslpltrpqaletqaaapqsdapdasagqtraapqgsaapalaaarakadelgqaarevras verqtayetrlaaqrsaaafsggeppqarreapgaeldearnaqtvsarlfegnlkgvaqsghamsaeq kqalqsglddvfadappqarsagapmlysanaaagqgmadsdlwdmisdqigkikdnylgvyenvvgqy tdfykafsdilsqmanwikpggdgnkvklnvdalkaaleklkkdfslgdnldnkkavlfpaqskdggiq ggsesdarkwakemglpdapppgfscvqkaadgnwvvvvdmtpidtmirdvgalgsgteleldnakfqa wqsgfkaqeenlkntlqtltqkysnanslfdnlvkvlsstisscletaksflqi
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.80 Rfree 0.298
    Matthews' coefficent 2.05 Rfactor 0.248
    Waters 15 Solvent Content 40.00

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2p7n
    1. The crystal structures of the Salmonella type III secretion system tip protein SipD in complex with deoxycholate and chenodeoxycholate
    S Chatterjee, D Zhong, BA Nordhues - Protein , 2011 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch