.
The Open Protein Structure Annotation Network
PDB Keyword
.

2p0v

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of BT3781 protein from Bacteroides thetaiotaomicron. To be Published
    Site NESGC
    PDB Id 2p0v Target Id BtR58
    Molecular Characteristics
    Source Bacteroides thetaiotaomicron
    Alias Ids TPS8781,PF06824, 1.50.10.10 Molecular Weight 54711.50 Da.
    Residues 481 Isoelectric Point 5.86
    Sequence mnitktlclcaalsgaagvqamenrefvtqqdntrvnnyqtnrpeaskrlfvsqeverqidhikqlltn aklawmfencfpntldttvhfdgkedtfvytgdihamwlrdsgaqvwpyvqlankdpelkkmlagvinr qfkcinidpyanafnmnseggewmsdltdmkpelherkweidslcypirlayhywkttgdasvfsdewl qaianvlktfkeqqrkddakgpyrfqrkteraldtmtndgwgnpvkpvgliasafrpsddattfqflvp snffavtslrkaaeilntvnrkpalakectaladevekalkkyavcnhpkygkiyafevdgfgnqllmd danvpslialpylgdvkvtdpiyqntrkfvwsednpyffkgsagegiggphigydmiwpmsimmkafts qndaeiktcikmlmdtdagtgfmhesfnkndpknftrawfawqntlfgelilklvnegkvdllnsiq
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.10 Rfree 0.234
    Matthews' coefficent 2.04 Rfactor 0.211
    Waters 468 Solvent Content 39.60

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2p0v
    1. Analysis of a New Family of Widely Distributed Metal-independent _-Mannosidases Provides Unique Insight into the Processing of N-Linked Glycans
    KJ Gregg, WF Zandberg, JH Hehemann - Journal of Biological , 2011 - ASBMB
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch