.
The Open Protein Structure Annotation Network
PDB Keyword
.

2ojl

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of Q7WAF1_BORPA from Bordetella parapertussis. To be Published
    Site NESGC
    PDB Id 2ojl Target Id BpR68
    Molecular Characteristics
    Source Bordetella parapertussis
    Alias Ids TPS8775,PF10262, 3.40.30.10 Molecular Weight 11120.22 Da.
    Residues 100 Isoelectric Point 6.89
    Sequence mitppdhppriaiqyctqcqwllraawmaqellstfgadlgevalvpgtggvfrihyngaplwdrevdg gfpeakvlkqrvrdhldpgrplghidgrpkp
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.10 Rfree 0.218
    Matthews' coefficent 1.68 Rfactor 0.198
    Waters 128 Solvent Content 26.83

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2ojl

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch