.
The Open Protein Structure Annotation Network
PDB Keyword
.

2oas

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of 4-hydroxybutyrate coenzyme A transferase (AtoA) from Shewanella oneidensis in complex with CoA, Northeast Structural Genomics Target SoR119. To be Published
    Site NESGC
    PDB Id 2oas Target Id SoR119
    Molecular Characteristics
    Source Shewanella oneidensis
    Alias Ids TPS9145,PF02550, 3.40.1080.10, 3.40.810.20, 3.30.750.70 Molecular Weight 45714.85 Da.
    Residues 428 Isoelectric Point 6.27
    Sequence mpaivcqsaleavslirsgetlwthsmgatpkvlldalakhaltldnitllqlhtegaeslshpsllgh lrhrcffggvptrpllqsgdadyvpiflsevpklfrsgeqkidtaiiqvsppdkhgmcslgisveatla acqvagkiiahinpqmprthgdgfihidrfaavyeqsaslpihsfatgdavslaigqhvaelvrdgdcl qmgigaipdavlscltghkdlgvhtelfsdgilqlvekgvinntkkrfypgklvtgfalgsqklydyvd dnpavifmdieqvndtsiirknpnvmainsalqvdltgqvcadsigtkiysgvggqmdfirgaglsegg rsvialpstaaggrisriasvlspgagvvttrahvhyivteygaanlkgrslreraqaliniahpdfre qlsrdafevwglnl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.40 Rfree 0.266
    Matthews' coefficent 2.12 Rfactor 0.225
    Waters 151 Solvent Content 41.95

    Ligand Information
    Ligands COA (COENZYME) x 2
    Metals

    Jmol

     
    Google Scholar output for 2oas
    1. Crystal structure of 4-hydroxybutyrate CoA-transferase from Clostridium aminobutyricum
    S Macieira, J Zhang, M Velarde, W Buckel - Biological , 2009 - degruyter.com
     
    2. Biochemical, Structural and Molecular Dynamics Analyses of the Potential Virulence Factor RipA from Yersinia pestis
    R Torres, RV Swift, N Chim, N Wheatley, B Lan - PloS one, 2011 - dx.plos.org
     
    3. Crystal structure of the complex between 4-hydroxybutyrate CoA-transferase from Clostridium aminobutyricum and CoA
    S Macieira, J Zhang, W Buckel - Archives of microbiology, 2012 - Springer
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch