.
The Open Protein Structure Annotation Network
PDB Keyword
.

2nys

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the hypothetical protein AGR_C_3712 from Agrobacterium tumefaciens. To be Published
    Site NESGC
    PDB Id 2nys Target Id AtR88
    Molecular Characteristics
    Source Agrobacterium tumefaciens
    Alias Ids TPS8738,2.30.30.220, PF04386 Molecular Weight 18898.39 Da.
    Residues 168 Isoelectric Point 5.05
    Sequence mgqdhirydilaqdalrgvirkvlgevaatgrlpgdhhffitfltgapgvrisqhlkskyaeqmtiviq hqfwdmkvtetgfeiglsfsdtpeklvipynairgfydpsvnfelefdvplaeeeemeeaeitaypvsh eakpasetpksgeekkegsvvsldafrkkq
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.70 Rfree 0.268
    Matthews' coefficent 3.34 Rfactor 0.242
    Waters 34 Solvent Content 63.23

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2nys
    1. MODELING PROTEIN INTERACTIONS THROUGH STRUCTURE ALIGNMENT
    R Sinha - 2011 - kuscholarworks.ku.edu
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch