The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Northeast Structural Genomics Consortium Target KpR49. To be Published
    Site NESGC
    PDB Id 2kvv Target Id KpR49
    Molecular Characteristics
    Source Klebsiella pneumoniae
    Alias Ids TPS33485,16795, PF06806 Molecular Weight 8193.97 Da.
    Residues 70 Isoelectric Point 9.22
    Sequence maqiifneewmvekalmartglgarqiesyrqgawiegvhfkrvspsgektlrgttwynypeinkfirds
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information


    Google Scholar output for 2kvv

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch