.
The Open Protein Structure Annotation Network
PDB Keyword
.

2kta

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution NMR structure of a domain of protein A6KY75 from Bacteroides vulgatus, Northeast Structural Genomics target BvR106A. To be Published
    Site NESGC
    PDB Id 2kta Target Id BvR106A
    Molecular Characteristics
    Source Bacteroides vulgatus
    Alias Ids TPS31832,16692, PF03457 Molecular Weight 7625.50 Da.
    Residues 63 Isoelectric Point 10.35
    Sequence nqnlqgewmknyeelksfvrkyrrfpkstegnlggwchtqrkmrkqgklpndrrllldkigfv
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2kta

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch