The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution NMR structure of the apo form of a ribonuclease H domain of protein DSY1790 from Desulfitobacterium hafniense, Northeast Structural Genomics target DhR1A. To be Published
    Site NESGC
    PDB Id 2kq2 Target Id DhR1A
    Related PDB Ids 2kw4 
    Molecular Characteristics
    Source Desulfitobacterium hafniense
    Alias Ids TPS31822,16578, 16807, PF00075, 3.30.420.10 Molecular Weight 14410.50 Da.
    Residues 129 Isoelectric Point 8.65
    Sequence ydvytdgsyvngqyawayafvkdgkvhyedadvgknpaaatmrnvageiaaalyavkkasqlgvkiril hdyagiafwatgewkakneftqayaklmnqyrgiysfekvkahsgnefndyvdmkaksal
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information


    Google Scholar output for 2kq2

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch