.
The Open Protein Structure Annotation Network
PDB Keyword
.

2kpu

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title NMR Structure of YbbR family protein Dhaf_0833 (residues 32-118) from Desulfitobacterium hafniense DCB-2. To be Published
    Site NESGC
    PDB Id 2kpu Target Id DhR29B
    Related PDB Ids 3lyw 
    Molecular Characteristics
    Source Desulfitobacterium hafniense
    Alias Ids TPS31824,16570, PF07949 Molecular Weight 8680.60 Da.
    Residues 79 Isoelectric Point 5.19
    Sequence fplaliakntpansmimtklpsvkvktegynpsvnvnelfayvdlsgsepgehdyevkvdpipnikive isprvvtlql
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2kpu

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch