.
The Open Protein Structure Annotation Network
PDB Keyword
.

2kpo

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution NMR structure of denovo designed rossmann 2x2 fold protein, Northeast Structural Genomics Consortium target OR16. To be Published
    Site NESGC
    PDB Id 2kpo Target Id OR16
    Molecular Characteristics
    Source Other
    Alias Ids TPS31841,16562, 3.40.50.10660, PF11495, 3.40.50.2300 Molecular Weight 11985.20 Da.
    Residues 102 Isoelectric Point 5.39
    Sequence mllyvliisndkklieearkmaekanlelrtvktedelkkyleefrkesqnikvlilvsndeeldkake laqkmeidvrtrkvtspdeakrwikefseeggs
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2kpo
    1. Predicting protein structures with a multiplayer online game
    S Cooper, F Khatib, A Treuille, J Barbero, J Lee - Nature, 2010 - nature.com
     
    2. Combining NMR ensembles and molecular dynamics simulations provides more realistic models of protein structures in solution and leads to better chemical shift
    J Lehtivarjo, K Tuppurainen, T Hassinen - Journal of Biomolecular , 2012 - Springer
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch