The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution NMR structure of Streptomyces coelicolor SCO3027 modeled with Zn+2 bound, Northeast Structural Genomics Consortium Target RR58. To be Published
    Site NESGC
    PDB Id 2kpi Target Id RR58
    Molecular Characteristics
    Source Streptomyces coelicolor
    Alias Ids TPS31740,PF03966,, 16556 Molecular Weight 6043.62 Da.
    Residues 56 Isoelectric Point 4.34
    Sequence mpleaglleilacpachapleerdaelictgqdcglaypvrdgipvllvdearrpe
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Metals ZN (ZINC) x 1


    Google Scholar output for 2kpi

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch