The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution NMR structure and DNA binding mode of the Mus81 n-terminal helix-hairpin-helix domain. To be Published
    Site NESGC
    PDB Id 2kp7 Target Id MmT1A
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS31794,16549, Molecular Weight 10533.79 Da.
    Residues 90 Isoelectric Point 10.86
    Sequence maepvrlgrkrplpvcpnplfvrwltewrdeaasrgrhtrfvfqkalrslqryplplrsgkeakilqhf gdrlcrmldeklkqhlasggd
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information


    Google Scholar output for 2kp7

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch