.
The Open Protein Structure Annotation Network
PDB Keyword
.

2kl8

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Northeast Structural Genomics Consortium Target OR15. To be Published
    Site NESGC
    PDB Id 2kl8 Target Id OR15
    Molecular Characteristics
    Source Other
    Alias Ids TPS28409,16387 Molecular Weight 8849.66 Da.
    Residues 76 Isoelectric Point 5.50
    Sequence emdirfrgddleafekalkemirqarkfagtvtytldgndleiritgvpeqvrkelakeaerlakefni tvtytir
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2kl8
    1. Protein disulfide isomerase: a critical evaluation of its function in disulfide bond formation
    F Hatahet, LW Ruddock - Antioxidants & redox signaling, 2009 - online.liebertpub.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch