The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution NMR Structure of protein yutD from B.subtilis, Northeast Structural Genomics Consortium Target Target SR232. To be Published
    Site NESGC
    PDB Id 2kl5 Target Id SR232
    Molecular Characteristics
    Source Bacillus subtilis
    Alias Ids TPS28431,16384, PF06265 Molecular Weight 12154.24 Da.
    Residues 102 Isoelectric Point 5.40
    Sequence migmsekrgeimiliqnaefelvhnfkdgfneeafkarysdilnkydyivgdwgygqlrlkgffddqnq katfetkistldeyiyeycnfgcayfvlkrirk
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information


    Google Scholar output for 2kl5

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch