The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title RpR325/RPA3574 from Rhodopseudomonas palustris. To be Published
    Site NESGC
    PDB Id 2kl0 Target Id RpR325
    Molecular Characteristics
    Source Rhodopseudomonas palustris
    Alias Ids TPS28427,16377, PF02597, Molecular Weight 6958.45 Da.
    Residues 65 Isoelectric Point 4.31
    Sequence mlvtingeqrevqsasvaalmteldctgghfavalnydvvprgkwdetpvtagdeieiltprqgg
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information


    Google Scholar output for 2kl0

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch