.
The Open Protein Structure Annotation Network
PDB Keyword
.

2kkv

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution NMR structure of an integrase domain from protein SPA4288 from Salmonella enterica, Northeast Structural Genomics Consortium Target SlR105H. To be Published
    Site NESGC
    PDB Id 2kkv Target Id SlR105H
    Molecular Characteristics
    Source Salmonella enterica
    Alias Ids TPS28441,16373, 1.10.150.130 Molecular Weight 12943.76 Da.
    Residues 112 Isoelectric Point 8.32
    Sequence ensgaytfetiarewhesnkrwsedhrsrvlrylelyifphigssdirqlktshllapikevdtsgkhd vaqrlqqrvtaimryavqndyidsnpasdmagalsttkarhyp
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2kkv

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch