The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution NMR structure of holo acyl carrier protein from Geobacter metallireducens. Northeast Structural Genomics Consortium Target GmR141. To be Published
    Site NESGC
    PDB Id 2kjs Target Id GmR141
    Related PDB Ids 2kwm 
    Molecular Characteristics
    Source Geobacter metallireducens
    Alias Ids TPS27238,16081, PF00550, 16860, 1.10.1200.10 Molecular Weight 8940.81 Da.
    Residues 79 Isoelectric Point 5.15
    Sequence mptldaltpifrqvfdddsivltretsandidawdslshmnlivslevhykikfalgelqklknvgdla dlvdkklark
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information


    Google Scholar output for 2kjs

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch