The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution NMR structure of the N-terminal Ubiquitin-like Domain from Tubulin-binding Cofactor B, CG11242, from Drosophila melanogaster. Northeast Structural Genomics Consortium Target FR629A (residues 8-92). To be Published
    Site NESGC
    PDB Id 2kjr Target Id FR629A
    Molecular Characteristics
    Source Drosophila melanogaster
    Alias Ids TPS28339,, 16338 Molecular Weight 9106.84 Da.
    Residues 85 Isoelectric Point 6.06
    Sequence gksdfikvnvsnshndavafevklakdltvaqlktkleiltggcagtmkvqvfkgdtcvstmdnndaql gyyansdglrlhvvds
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information


    Google Scholar output for 2kjr

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch