The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution Structure Of Protein NMB1076 From Neisseria meningitidis. Northeast Structural Genomics Consortium Target MR101B. To be Published
    Site NESGC
    PDB Id 2kjq Target Id MR101B
    Molecular Characteristics
    Source Neisseria meningitidis
    Alias Ids TPS28380,, 16336 Molecular Weight 15611.88 Da.
    Residues 138 Isoelectric Point 5.03
    Sequence dypsfdkflgtenaelvyvlrhkhgqfiyvwgeegagkshllqawvaqaleagknaayidaasmpltda afeaeylavdqveklgneeqallfsifnrfrnsgkgflllgseytpqqlviredlrtrmayclvyevkp
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information


    Google Scholar output for 2kjq

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch