The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of protein YlbL (BSU15050) from Bacillus subtilis, Northeast Structural Genomics Consortium target sr713a. To be Published
    Site NESGC
    PDB Id 2kjp Target Id SR713A
    Molecular Characteristics
    Source Bacillus subtilis
    Alias Ids TPS28435,PF00595, 16335, Molecular Weight 8910.66 Da.
    Residues 81 Isoelectric Point 8.12
    Sequence ngiyassvvenmpakgkievgdkiisadgknyqsaeklidyisskkagdkvtlkiereekekrvtltlk qfpdepdragig
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information


    Google Scholar output for 2kjp

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch