The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title NMR structure of IntB phage-integrase-like protein fragment 90-199 from Erwinia carotova subsp. atroseptica. To be Published
    Site NESGC
    PDB Id 2kj9 Target Id EwR217E
    Molecular Characteristics
    Source Erwinia carotovora
    Alias Ids TPS28336,16316, Molecular Weight 12868.22 Da.
    Residues 110 Isoelectric Point 9.58
    Sequence ksvqekrnntrafktvakswfatkttwsedyqrsvwtrletylfpdignkdiaeldtgdllvpikkiek lgyleiamrvkqyataimryavqqkmirfnpaydlegavqk
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information


    Google Scholar output for 2kj9

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch