The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution NMR structure of a domain from a putative phage integrase protein Nmul_A0064 from Nitrosospira multiformis, Northeast Structural Genomics Consortium Target NmR46C. To be Published
    Site NESGC
    PDB Id 2kj5 Target Id NmR46C
    Molecular Characteristics
    Source Nitrosospira multiformis
    Alias Ids TPS28399,16312, Molecular Weight 12174.42 Da.
    Residues 107 Isoelectric Point 9.69
    Sequence aeknaytvaqladeyfermiagrwkhpnivrsriekdikpaigslkvedvkprhiddvlkavmkrgaps iandtlrwlkrmfnyaikrhiieynpaaafdpgdaggk
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information


    Google Scholar output for 2kj5

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch