.
The Open Protein Structure Annotation Network
PDB Keyword
.

2kiw

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution NMR structure of the domain N-terminal to the integrase domain of SH1003 from Staphylococcus haemolyticus. Northeast Structural Genomics Consortium Target ShR105F (64-166). To be Published
    Site NESGC
    PDB Id 2kiw Target Id ShR105F
    Molecular Characteristics
    Source Staphylococcus haemolyticus
    Alias Ids TPS28439,1.10.150.130, 16298 Molecular Weight 12029.20 Da.
    Residues 103 Isoelectric Point 9.73
    Sequence tfkqvaddwlkqyandvkvssvrarekaiqhaierfntkpiqtikkhdyqrfvddisaqysknyvdsiv astnmifkyaydtrlikampsegikrpkkkvsve
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2kiw

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch