.
The Open Protein Structure Annotation Network
PDB Keyword
.

2khq

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution NMR structure of a phage integrase SSP1947 fragment 59-159 from Staphylococcus saprophyticus. To be Published
    Site NESGC
    PDB Id 2khq Target Id SyR103B
    Molecular Characteristics
    Source Staphylococcus saprophyticus
    Alias Ids TPS27310,16251, 1.10.150.130 Molecular Weight 12302.26 Da.
    Residues 101 Isoelectric Point 9.01
    Sequence itfadyfyqwyevnklphvsestkrhyesaykhikdhfrhkllkdikrteyqkflneyglthsyetirk lnsyirnafddaihegyviknptykaelhasv
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2khq
    1. Crystal structure of the parasite inhibitor chagasin in complex with papain allows identification of structural requirements for broad reactivity and specificity
    I Redzynia, A Ljunggren, A Bujacz - FEBS , 2009 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch