The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution NMR structure of VC_A0919 from Vibrio cholerae. Northeast Structural Genomics Consortium Target VcR52. To be Published
    Site NESGC
    PDB Id 2khd Target Id VcR52
    Molecular Characteristics
    Source Vibrio cholerae
    Alias Ids TPS27317,16238, PF04175, Molecular Weight 10971.79 Da.
    Residues 100 Isoelectric Point 4.67
    Sequence msnqtcvenevceacgcageigfiiregddvaevslfgsdkahlegklaeyislakqvyanveyevapv adnatelharfkfevsaeklifelktralar
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information


    Google Scholar output for 2khd

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch