.
The Open Protein Structure Annotation Network
PDB Keyword
.

2kf2

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution NMR Structure of Streptomyces coelicolor polyketide cyclase SCO5315. To be Published
    Site NESGC
    PDB Id 2kf2 Target Id RR365
    Molecular Characteristics
    Source Streptomyces coelicolor
    Alias Ids TPS27285,3.30.530.20, PF10604, PF03364 Molecular Weight 18196.46 Da.
    Residues 159 Isoelectric Point 4.65
    Sequence maghtdneitiaapmelvwnmtndiekwpglfseyasvevlgrdddkvtfrltmhpdadgkvwswvser vadpvtrtvraqrvetgpfqymnivweyaetaegtvmrwtqdfamkpdapvddawmtdninrnsrtqma lirdrieqaagerrtasvlad
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2kf2
    1. Effects of Cu Ions and Explicit Water Molecules on the Copper Binding Domain of Amyloid Precursor Protein APP (131-189) a Molecular Dynamics Study
    Q Wang, NH Werstiuk, J Kramer - The Journal of Physical , 2011 - ACS Publications
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch