.
The Open Protein Structure Annotation Network
PDB Keyword
.

2kew

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title (1)H, (13)C, and (15)N NMR assignments for the Bacillus subtilis yndB START domain. Biomol.Nmr Assign. 3 191-194 2009
    Site NESGC
    PDB Id 2kew Target Id SR211
    Related PDB Ids 2kte 
    Molecular Characteristics
    Source Bacillus subtilis
    Alias Ids TPS28429,PF10604, 3.30.530.20, PF08327, - Molecular Weight 16119.39 Da.
    Residues 144 Isoelectric Point 4.83
    Sequence maqnnenalpditksitleapiqkvwetvstsegiakwfmpndfqlkegqefhlqspfgpspckvlavq aptelsfewdtegwvvtfqledlgektgftlihsgwkepnevigkanekssvvrgkmdggwtgivnerl rkavee
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2kew

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch