.
The Open Protein Structure Annotation Network
PDB Keyword
.

2ken

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title NMR structure of the OB domain of MM0293 from the archea Methanosarcina mazei. To be Published
    Site NESGC
    PDB Id 2ken Target Id MaR214A
    Related PDB Ids 2kbn 
    Molecular Characteristics
    Source Methanosarcina mazei
    Alias Ids TPS27269,16051, PF01336, 2.40.50.140 Molecular Weight 11306.27 Da.
    Residues 100 Isoelectric Point 4.69
    Sequence epqltkivdivengqwanlkakviqlwenthesisqvgllgdetgiikftiwknaelplleqgesyllr svvvgeyndrfqvqvnknssieklsepievg
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2ken

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch