The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution NMR structure of F5/8 type C-terminal domain of a putative chitobiase from Bacteroides thetaiotaomicron. To be Published
    Site NESGC
    PDB Id 2kd7 Target Id BtR324B
    Molecular Characteristics
    Source Bacteroides thetaiotaomicron
    Alias Ids TPS27209,PF00754,, 16107 Molecular Weight 16359.48 Da.
    Residues 150 Isoelectric Point 4.99
    Sequence gtkisksgwevlsfttqeasgegagnglakclidgdtetfwhakwqggsdplpydividmkqniqiaqv ellprgrgsnnpikvvefaasednvnwtpigrfgftnqdaaleyyvksikaryirltipddggnstvaa ireldvkgtiin
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information


    Google Scholar output for 2kd7

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch