.
The Open Protein Structure Annotation Network
PDB Keyword
.

2kcx

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution NMR Structure of Kazal-1 Domain of Human Follistatin-related protein 3 (FSTL-3). Northeast Structural Genomics Target HR6186A. To be Published
    Site NESGC
    PDB Id 2kcx Target Id HR6186A
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS28362,1.10.1890.10, PF07648, PF00050, PF09289, 3.30.60.30 Molecular Weight 7966.61 Da.
    Residues 74 Isoelectric Point 8.38
    Sequence sdscdgvecgpgkacrmlggrprcecapdcsglparlqvcgsdgatyrdecelraarcrghpdlsvmyr grcrk
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2kcx
    1. Expression, functional, and structural analysis of proteins critical for otoconia development
    Y Xu, H Zhang, H Yang, X Zhao, S Lovas - Developmental , 2010 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch