The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution NMR structure of an uncharacterized protein from Chlorobium tepidum. Northeast Structural Genomics target CtR107. To be Published
    Site NESGC
    PDB Id 2kcu Target Id CtR107
    Related PDB Ids 3e0h 
    Molecular Characteristics
    Source Chlorobium tepidum
    Alias Ids TPS20378,, PF06445, 16097 Molecular Weight 17083.31 Da.
    Residues 158 Isoelectric Point 4.28
    Sequence mdfecqfvcelkelapvpallirtqttmselgslfeagyhdilqllagqgkspsgppfaryfgmsagtf evefgfpveggvegsgrvvtgltpsgkaasslyigpygeieavydalmkwvddngfdlsgeayeiyldn paetapdqlrtrvslmlhes
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information


    Google Scholar output for 2kcu

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch