.
The Open Protein Structure Annotation Network
PDB Keyword
.

2kco

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution NMR structure of ribosomal protein sso0164 from Sulfolobus solfataricus. To be Published
    Site NESGC
    PDB Id 2kco Target Id SsT4
    Molecular Characteristics
    Source Sulfolobus solfataricus
    Alias Ids TPS27303,PF01201, BIG_745, 16089 Molecular Weight 14658.15 Da.
    Residues 133 Isoelectric Point 10.35
    Sequence mgfyqgpdnrkitgglkgkhrdkrkyeignpptfttlsaedirikdrtlggnfkvrlkytttanvldpa tntakkvkileiletpankelarrgiiirgakirteaglavvtsrpgqdgvinavllknesqrs
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2kco
    1. A novel strategy for NMR resonance assignment and protein structure determination
    A Lemak, A Gutmanas, S Chitayat, M Karra - Journal of biomolecular , 2011 - Springer
     
    2. of meningococcal disease
    AR Gorringe, R Pajon - 2012 - landesbioscience.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch