.
The Open Protein Structure Annotation Network
PDB Keyword
.

2kan

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution NMR structure of ubiquitin-like domain of Arabidopsis thaliana protein At2g32350. To be Published
    Site NESGC
    PDB Id 2kan Target Id AR3433A
    Molecular Characteristics
    Source Arabidopsis thaliana
    Alias Ids TPS27186,3.10.20.90, PF00240, PF11976, 16029 Molecular Weight 9747.68 Da.
    Residues 84 Isoelectric Point 8.23
    Sequence aavrkihvtvkfpskqftvevdrtetvsslkdkihiventpikrmqlyysgieladdyrnlneygitef seivvflksinrakd
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2kan

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch