.
The Open Protein Structure Annotation Network
PDB Keyword
.

2k5v

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title SOLUTION NMR STRUCTURE OF the second OB-fold domain of replication protein A from Methanococcus maripaludis. NORTHEAST STRUCTURAL GENOMICS TARGET MrR110B. To be Published
    Site NESGC
    PDB Id 2k5v Target Id MrR110B
    Related PDB Ids 3e0e 
    Molecular Characteristics
    Source Methanococcus maripaludis
    Alias Ids TPS8976,PF01336, 2.40.50.140, 15849 Molecular Weight 10445.27 Da.
    Residues 95 Isoelectric Point 5.43
    Sequence nykiselmpnlsgtinaevvtaypkkefsrkdgtkgqlkslflkddtgsirgtlwneladfevkkgdia evsgyvkqgysgleisvdnigiieks
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2k5v

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch