.
The Open Protein Structure Annotation Network
PDB Keyword
.

2k5p

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title NMR Solution Structure of a Thiamine Biosynthesis Protein from Geobacter Metallireducens: Northeast Structural Genomics Consortium Target GmR137. To be Published
    Site NESGC
    PDB Id 2k5p Target Id GmR137
    Related PDB Ids 3cwi 
    Molecular Characteristics
    Source Geobacter metallireducens
    Alias Ids TPS8898,PF02597, 15844, 3.10.20.30 Molecular Weight 7453.97 Da.
    Residues 70 Isoelectric Point 4.19
    Sequence mnltvngkpstvdgaeslnvtellsalkvaqaeyvtvelngevlereafdattvkdgdaveflyfmgggk
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2k5p

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch