.
The Open Protein Structure Annotation Network
PDB Keyword
.

2k5n

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title NMR Structure of the Putative Cold Shock Protein from Erwinia carotovora: Northeast Structural Genomics Consortium Target EwR156a. To be Published
    Site NESGC
    PDB Id 2k5n Target Id EwR156A
    Molecular Characteristics
    Source Erwinia carotovora
    Alias Ids TPS8883,2.40.50.140, PF00313, 15843 Molecular Weight 7336.05 Da.
    Residues 66 Isoelectric Point 9.05
    Sequence mamngtittwfkdkgfgfikdengdnryfhvikvanpdlikkdaavtfepttnnkglsayavkvvp
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2k5n

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch